PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676751498
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family EIL
Protein Properties Length: 588aa    MW: 66364.7 Da    PI: 5.0712
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676751498genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3439.33.4e-134404031351
                XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
       EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekve 100
                e+l++rmwkd+++lkr+ker+k+    +  a  ++  +k+++qa+rkkmsraQDgiLkYMlk mevc+++GfvYgiipekgkpv+g+sd++raWWkekv+
  676751498  40 EDLERRMWKDRVRLKRIKERQKSGS--QG-AQTKEMPKKISDQAQRKKMSRAQDGILKYMLKLMEVCKVRGFVYGIIPEKGKPVSGSSDNIRAWWKEKVK 136
                89********************965..33.35567789************************************************************** PP

                XXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG CS
       EIN3 101 fdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphd 200
                fd+ngpaai+ky+ ++l++++++++    ++++  l++lqD+tlgSLLs+lmqhcdppqr++plekg++pPWWPtG+e+ww +lgl+k+q+ ppy+kphd
  676751498 137 FDKNGPAAIAKYEEECLAFGKSDGN----RNSQFVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGTPPPWWPTGNEEWWVKLGLPKSQS-PPYRKPHD 231
                *******************987777....77999*********************************************************.9******* PP

                --HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX...XX.....XXXX....XXXXXXXXXXXXXXXXXXX CS
       EIN3 201 lkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah...ss.....slrk....qspkvtlsceqkedvegkk 288
                lkk+wkv+vLtavi+hmsp+i++i++++rqsk+lqdkm+akes+++l+vlnqee+++++ s++   s+        +    +++k+++++++++dv+g++
  676751498 232 LKKMWKVGVLTAVINHMSPDIAKIKRHVRQSKCLQDKMTAKESAIWLAVLNQEESLIQQPSSDngtSNvtethR--RgnnaDRRKTVINSDSDYDVDGTE 329
                ***************************************************************65422787540..33445888999**********999 PP

                XXX.XXXXXXXXXX..................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXX CS
       EIN3 289 eskikhvqavktta..................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisq 351
                e + + ++++++++                  +++ +r+rk+++s+s +v       + q+++ ++ e+++i++d+n+++ 
  676751498 330 EASGSVSSKDNRRNqiqkeqptatsqpvsdqdKVEKHRRRKRPRSRSGTV-------NRQEEEQPEAEQRNILPDMNHVDA 403
                99999999999888999999999966555444444444444333333333.......345566667899999999999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.9E-12640285No hitNo description
Gene3DG3DSA:1.10.3180.101.7E-71161293IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167686.8E-61166288IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MGGGDPAPSG ADIRMENEPD DLASDNVAEI DVSDEEIDAE DLERRMWKDR VRLKRIKERQ  60
KSGSQGAQTK EMPKKISDQA QRKKMSRAQD GILKYMLKLM EVCKVRGFVY GIIPEKGKPV  120
SGSSDNIRAW WKEKVKFDKN GPAAIAKYEE ECLAFGKSDG NRNSQFVLQD LQDATLGSLL  180
SSLMQHCDPP QRKYPLEKGT PPPWWPTGNE EWWVKLGLPK SQSPPYRKPH DLKKMWKVGV  240
LTAVINHMSP DIAKIKRHVR QSKCLQDKMT AKESAIWLAV LNQEESLIQQ PSSDNGTSNV  300
TETHRRGNNA DRRKTVINSD SDYDVDGTEE ASGSVSSKDN RRNQIQKEQP TATSQPVSDQ  360
DKVEKHRRRK RPRSRSGTVN RQEEEQPEAE QRNILPDMNH VDAPLLDYNI NDTHHHEEGV  420
LEPNIALGPE ENGLELVVPE FDNNYTYLPP VNGQAMMPVD ERPMLYGSNP NQELQFGSGY  480
NYYNPSAVFV HNQEEDIIHT PIEINAQAQP HNNGFEAPGG VLRPHDLLGN EDGVAGRDLP  540
PQFPSDQEKL LDSNILSPFN DLTFDSSTFY SGFDSYGAFD DDYSWFGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A3e-861652969140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3532450.0AK353245.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-23-B16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390517.10.0hypothetical protein EUTSA_v10018327mg
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLE4MXJ80.0E4MXJ8_EUTHA; mRNA, clone: RTFL01-23-B16
TrEMBLV4KKK70.0V4KKK7_EUTSA; Uncharacterized protein
STRINGBra015970.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46582548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.10.0ETHYLENE-INSENSITIVE3-like 3